PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10042057
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 561aa    MW: 61219.1 Da    PI: 7.0975
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10042057genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.83.1e-10408466563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  kr++r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+  +  l++++
  Lus10042057 408 KRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSLGLTNQN 466
                  9*********************************************9998888777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.8E-18404468IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.726406469IPR004827Basic-leucine zipper domain
PfamPF001701.3E-8408459IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.52E-11408459No hitNo description
Gene3DG3DSA:1.20.5.1701.5E-10408463No hitNo description
CDDcd147033.22E-24409458No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
MGDTEEGSTD VMQRLQSSFG TNQSSTSSSM LKQLPFSSSP RQIDIPPLSQ NQMRARHFAH  60
FAQQQGFSGG GGDSNSNNNK RAGIPPSHPN QITPISPFSQ IPVSTRPVNH HQMGSSQSFN  120
TTNKPGHSRS LSQPSSFFSL DSLPPLSPAS FRDHSPTSET DASMEVDRDG NYHSVLPPSP  180
YSRSSSIAPR VGESLPPRKA HRRSNSDIPF GFSTVMQSSP PLKFGNKLAQ VVKNEEGMGE  240
RKPEGEAMDD LFSAYMNLDN FDSLNSSGTD DKNGNENRED LDSRASGTKT NGGDSSDNEA  300
ESSINESGSS IPRREGTKRS AEGDIAPTSR HHRSVSLDSF MGKLNFGGDE SPKLPPSPGP  360
RPGQLSPTSS IDGSAFSLDF GNGEFNSVEL KKIMANEKLT EIALTDPKRA KRILANRQSA  420
ARSKERKMRY ISELEHKVQT LQTEATTLSA QLTLLQRDSL GLTNQNNELK FRLQAMEQQA  480
QLRDALNEAL TAEVRRLKIA TAEISENSAD PSKGSQHHTS ANSQMFQQQQ QMSSQCNMNQ  540
LQQQQHEQRN GTNSKAEANQ *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012084427.10.0PREDICTED: transcription factor RF2a-like
TrEMBLA0A067K7430.0A0A067K743_JATCU; Uncharacterized protein
STRINGPOPTR_0004s17080.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22723484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-129bZIP family protein